PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn366151
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 294aa    MW: 32986.5 Da    PI: 5.0676
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn366151genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.11.4e-3810108199
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaCk++rr+C+++C+lapyfp +qpk f+n+hklFG+sn+lk+lk+l++ ++ +am+s++y+A++r r Pv+G++ v+++lq q++q+++el ++ +
  Achn366151  10 ACAACKYQRRRCSTECPLAPYFPPDQPKMFQNAHKLFGVSNILKILKQLNTVQKMEAMRSIIYQANIRDRFPVHGCCWVMSQLQYQIQQAEEELYAVLA 108
                 7********************************************************************************************987655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.999110IPR004883Lateral organ boundaries, LOB
PfamPF031958.2E-3710105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MTLKGGTSQA CAACKYQRRR CSTECPLAPY FPPDQPKMFQ NAHKLFGVSN ILKILKQLNT  60
VQKMEAMRSI IYQANIRDRF PVHGCCWVMS QLQYQIQQAE EELYAVLAQI AFFQQQKQQQ  120
QQQEINNNNN VNDSASQLQA LSLFHQEAPV NADASALPIA SSYPNVAAAY SSGYPDHKDN  180
LVNSFWVQQH PYVNGNNNSS NSNNNNNNNI SMAMQSQMVS SPQLIIQQEQ AQEYDEMHPF  240
FDTIDDRQSY IDSKEAYDSS SDSSLKDTTQ SVEHIADNEL KSAAACFSLT SVN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511502.11e-119PREDICTED: LOB domain-containing protein 27
SwissprotQ9STS62e-61LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A068UF741e-119A0A068UF74_COFCA; Uncharacterized protein
STRINGPOPTR_0012s07390.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14492375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.17e-51LOB domain-containing protein 27